Recombinant Human B3GALT1 Protein Summary
| Description |
B3GALT1 (Human) GST-Tagged Recombinant Protein (Q01)
Source: Wheat Germ (in vitro) Amino Acid Sequence: NPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYH |
| Preparation Method |
in vitro wheat germ expression system
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
B3GALT1
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human B3GALT1 Protein
- beta-1,3-galactosyltransferase 1
- Beta-1,3-GalTase 1
- beta3GalT1
- beta-3-galt1
- beta3Gal-T1
- EC 2.4.1
- EC 2.4.1.-
- EC 2.4.1.62
- MGC126594
- UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1
- UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1
Background
This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose. [provided by RefSeq]
