Recombinant Human Defensin alpha 3 Protein Summary
| Description |
Defensin alpha 3 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
DEFA3
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Defensin alpha 3 Protein
- DEF3
- Defensin, alpha 3
- defensin, alpha 3, neutrophil-specific
- HNP3
- HNP-3defensin 3, neutrophil-specific
- HP3
- HP-3
- neutrophil defensin 3
- neutrophil peptide 3
Background
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 1 by only one amino acid. [provided by RefSeq]
