Recombinant Human CAR/NR1I3 Protein Summary
| Description |
CAR/NR1I3 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: ASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQ |
| Preparation Method |
in vitro wheat germ expression system
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
NR1I3
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CAR/NR1I3 Protein
- CAR
- CARCAR1
- Constitutive activator of retinoid response
- constitutive active receptor
- Constitutive active response
- Constitutive androstane receptor
- MB67
- MGC150433
- MGC97144
- MGC97209
- NR1I3
- nuclear receptor subfamily 1 group I member 3
- nuclear receptor subfamily 1, group I, member 3
- orphan nuclear hormone receptor
- Orphan nuclear receptor MB67
Background
This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
